Analytical Data
-
Gene name
CUTL1
- Application
-
Alternative Names
Homeobox protein cut-like 1. CCAAT displacement protein. CDP. CDP/Cux p200. Homeobox protein cux-1. Cleaved into: CDP/Cux p110
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P39880
-
Expression Region
521-620aa
-
AA Sequence
AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CUTL1 (also known as Cux1 or Cut-like homeobox 1) is a transcription factor that plays a crucial role in various biological processes, including development, cellular differentiation, and tumorigenesis. It is a member of the Cut homeobox gene family, which is involved in the regulation of gene expression during developmental stages. Research has increasingly focused on CUTL1 due to its involvement in multiple signaling pathways and its potential link to cancer progression. Abnormal expression of CUTL1 has been observed in various cancers, suggesting it may play a role in oncogenic processes. Moreover, CUTL1 is implicated in the regulation of cell cycle progression and apoptosis, further highlighting its significance in maintaining cellular homeostasis. The use of recombinant protein technology to produce CUTL1 allows for in-depth studies into its structure and function, enabling researchers to explore its mechanisms of action and potential as a therapeutic target. Understanding the role of CUTL1 in cellular contexts can shed light on its potential involvement in diseases and provide insights into novel approaches for cancer treatment and prevention. With advances in protein expression systems, including bacterial, yeast, and mammalian cells, the generation of high-purity CUTL1 recombinant protein facilitates functional assays and structural analyses, which are vital for deciphering its biological activities and interactions within the cellular milieu. Thus, ongoing research into CUTL1 recombinant protein serves as a critical stepping stone toward unraveling its complex functions and therapeutic potentials in oncology and regenerative medicine.
