Analytical Data
-
Gene name
SLC35B1
- Application
-
Alternative Names
SLC35B1; UGTREL1Solute carrier family 35 member B1; UDP-galactose transporter-related protein 1; UGTrel1; hUGTrel1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78383
-
Expression Region
1-322 aa
-
AA Sequence
MASSSSLVPDRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFDTARVDRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTVGYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGTVLVFLGLGLDAKFGKGAKKTSH
-
Molecular Weight
62.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC35B1, a member of the solute carrier (SLC) family, has garnered attention in recent years due to its pivotal role in nucleotide sugar transport across the endoplasmic reticulum and Golgi apparatus, which are essential for glycosylation processes. Glycosylation is a critical post-translational modification that affects protein folding, stability, and cell signaling, thereby influencing various biological functions and disease states. Mutations or disruptions in SLC35B1 have been linked to glycosylation disorders, which can lead to severe developmental and health issues. As researchers aim to better understand the functional mechanisms of SLC35B1, recombinant protein studies have emerged as vital tools. The expression and purification of SLC35B1 as a recombinant protein enable detailed investigations into its structure-function relationships and interaction with other cellular components. Additionally, studying SLC35B1 can provide insights into potential therapeutic targets for diseases resulting from glycosylation defects. By elucidating the intricate role of SLC35B1 in cellular metabolism and its implications in health and disease, researchers hope to pave the way for novel treatments and enhanced understanding of glycan-related pathologies.
