Analytical Data
-
Gene name
SLC35A4
- Application
-
Alternative Names
SLC35A4; Probable UDP-sugar transporter protein SLC35A4; Solute carrier family 35 member A4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96G79
-
Expression Region
1-324 aa
-
AA Sequence
MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQAWPQGPPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTAVLYCLCLRHRLSVRQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQNLFLYTFGVLLNLGLHAGGGSGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRLQLTAAFFLATLLIGLAMRLYYGSR
-
Molecular Weight
61 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC35A4 is a member of the solute carrier family, specifically classified as a nucleotide sugar transporter, and plays a crucial role in the intracellular transport of nucleotide sugars, which are essential for glycosylation processes. This protein has garnered significant interest due to its implications in various biological functions and pathologies, including its association with congenital disorders of glycosylation (CDG). Mutations in the SLC35A4 gene have been linked to type II CDG, a condition characterized by developmental delays, neurocognitive impairment, and various systemic issues. Understanding the structure and function of SLC35A4 through recombinant protein studies can shed light on its transport mechanisms and substrate specificity, providing insights into how its dysfunction leads to disease. Furthermore, the development of recombinant SLC35A4 can facilitate the exploration of therapeutic avenues, such as gene therapy or enzyme replacement strategies, to address glycosylation defects. By elucidating the molecular details of SLC35A4 activity, researchers aim to pave the way for potential interventions that could ameliorate the clinical symptoms associated with SLC35A4-related disorders and enhance our understanding of glycosylation's role in human health and disease.











