Analytical Data
-
Gene name
OXNAD1
- Application
-
Alternative Names
OXNAD1；Oxidoreductase NAD-binding domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96HP4
-
Expression Region
18-312aa
-
AA Sequence
AIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW
-
Molecular Weight
49.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OXNAD1 (Oxidation Resistance 1 Homolog) is a recently identified protein involved in cellular redox homeostasis and oxidative stress responses. Research has shown that OXNAD1 plays a significant role in various biological processes, including metabolism, apoptosis, and cellular differentiation. Its homologs have been linked to conditions such as cancer and neurodegenerative diseases, indicating its potential importance in disease mechanisms. The protein's unique structure and functional domains suggest that it may interact with other oxidative stress-related molecules, making it a candidate for therapeutic interventions. Understanding the expression patterns and regulatory mechanisms of OXNAD1 is crucial for elucidating its role in health and disease. Recent advances in recombinant protein technology have facilitated the production of OXNAD1 for functional studies and investigations into its biochemical properties. By generating and characterizing recombinant OXNAD1, researchers aim to uncover its specific functions and potential as a biomarker or therapeutic target, paving the way for novel approaches to treat diseases associated with oxidative stress.
