Cat: PAX2000-11402

Recombinant Human SLC25A4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC25A4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ADP.ATP carrier protein 1;ADP.ATP carrier protein. heart/skeletal muscle isoform T1;Adenine nucleotide translocator 1;Solute carrier family 25 member 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12235

  • Expression Region

    2-298 aa

  • AA Sequence

    GDHAWSFLKDFLAGGVAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGGATSLCFVYPLDFARTRLDVGKGQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

  • Molecular Weight

    34.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC25A4, also known as the adenine nucleotide translocator 1 (ANT1), is a crucial protein encoded by the SLC25A4 gene, responsible for the transport of adenine nucleotides across the mitochondrial inner membrane. This protein plays a vital role in cellular energy metabolism by facilitating the exchange of ATP and ADP between the mitochondria and the cytosol, thus influencing ATP production and mitochondrial function. The importance of SLC25A4 is underscored by its involvement in various metabolic disorders and diseases, including myopathies and mitochondrial diseases. Investigating the recombinant protein of SLC25A4 can provide insights into its structural and functional properties, aiding in the understanding of its role in cellular metabolism and potential therapeutic targets. Recent studies have focused on the characterization of SLC25A4 through recombinant expression systems, allowing researchers to analyze its transport mechanisms, interaction with other mitochondrial proteins, and impact on energy homeostasis. Furthermore, understanding the mutations and variations in the SLC25A4 gene may contribute to the development of gene therapy strategies for related mitochondrial dysfunctions. As mitochondrial dysfunction is linked to numerous diseases, including neurodegenerative disorders and cancer, the study of SLC25A4 presents significant implications for advancing therapeutic approaches and enhancing our understanding of mitochondrial biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US