Analytical Data
-
Gene name
IL22RA1
- Application
-
Alternative Names
IL22RA1；IL22R；Interleukin-22 receptor subunit alpha-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6P7
-
Expression Region
250-573aa
-
AA Sequence
SYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE
-
Molecular Weight
50.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL22RA1, or Interleukin 22 Receptor Alpha 1, is a critical component of the interleukin-22 signaling pathway, which plays a significant role in the immune response and inflammation. This receptor is primarily expressed in epithelial tissues and is known to mediate the effects of IL-22, a cytokine involved in various physiological processes, including tissue homeostasis, repair, and pathogen defense. Dysregulation of IL-22 signaling has been implicated in several inflammatory and autoimmune diseases, such as psoriasis, inflammatory bowel disease, and asthma. Researchers have focused on the reconstitution of IL22RA1 as a recombinant protein to better understand its structure, function, and interactions with IL-22. Such studies are crucial for revealing the mechanisms underlying IL-22-mediated signaling and its role in pathological states. The recombinant IL22RA1 can be utilized in various experimental settings, including therapeutic development and drug testing, providing insights into potential interventions targeting the IL-22/IL22RA1 axis. By elucidating the role of IL22RA1 in immune regulation and its downstream effects, scientists aim to identify novel biomarkers and therapeutic targets that could lead to improved treatment strategies for patients suffering from related diseases.
