Analytical Data
-
Gene name
CRCP
- Application
-
Alternative Names
Calcitonin gene related peptide receptor component; Calcitonin gene related peptide receptor component protein; Calcitonin gene-related peptide-receptor component protein; CGRP receptor component protein; CGRP-RCP
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75575
-
Expression Region
1-148aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cyclic Ribonucleotide Cyclases and Phosphodiesterases (CRCP) are emerging as critical components in the regulation of nucleotide signaling pathways, particularly in the context of cyclic adenosine monophosphate (cAMP) and cyclic guanosine monophosphate (cGMP) in cellular processes. The study of recombinant CRCP proteins has garnered attention due to their potential roles in diverse biological functions, including signal transduction, gene expression, and cellular responses to environmental stimuli. Researchers have focused on characterizing the enzymatic properties of these proteins, including their substrate specificities and catalytic mechanisms, to understand how they modulate intracellular signaling pathways. Importantly, the dysregulation of CRCP activities has been implicated in various diseases, such as cancer, cardiovascular disorders, and neurodegenerative diseases, making them attractive targets for therapeutic intervention. Advances in recombinant DNA technology have facilitated the production of CRCP proteins in sufficient quantities for biochemical and structural studies, allowing for the exploration of their functional roles in health and disease. By elucidating the mechanisms through which CRCP proteins operate, researchers hope to uncover novel strategies for drug development aimed at restoring normal signaling pathways in pathological conditions. Overall, CRCP recombinant protein research is positioned at the intersection of molecular biology and therapeutic innovation, offering promising insights into the fundamental processes of life and the potential for addressing significant health challenges.
