Analytical Data
-
Gene name
CHD1L
- Application
-
Alternative Names
CHD1L;ALC1;Chromodomain-helicase-DNA-binding Protein 1-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86WJ1
-
Expression Region
704-897aa
-
AA Sequence
SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP
-
Molecular Weight
37.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHD1L (Chromodomain Helicase DNA-Binding Protein 1-Like) is a member of the chromodomain helicase DNA-binding (CHD) family, which plays a crucial role in diverse cellular processes, including chromatin remodeling, gene regulation, and DNA repair. Recent studies have suggested that CHD1L is involved in various biological functions, particularly in cancer biology, where its expression levels are often associated with tumor progression and poor prognosis. Understanding the structure and function of recombinant CHD1L protein is essential for elucidating its role in these processes. Researchers have focused on producing recombinant CHD1L to investigate its interactions with DNA and other proteins, as well as its potential regulatory mechanisms. Initial experiments have shown that CHD1L possesses ATPase activity, which may contribute to its chromatin remodeling functions. Furthermore, there is ongoing research into its implications in specific types of cancer, such as breast and colorectal cancer, where aberrant expression patterns of CHD1L have been observed. Given its potential as a therapeutic target, further investigation into the biochemical properties and molecular mechanisms of CHD1L is vital. Understanding how this protein operates within the cellular context could pave the way for novel therapeutic strategies aimed at modulating its activity, offering hope for improved cancer treatments and better outcomes for patients. Overall, the study of recombinant CHD1L represents a significant step toward unlocking the complexities of chromatin dynamics and their impact on human health.











