Analytical Data
-
Gene name
CRB1
- Application
-
Alternative Names
CRB1; CRUM1_HUMAN; Protein crumbs homolog 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P82279
-
Expression Region
26-134aa
-
AA Sequence
FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVC
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRB1 (crumbs homologue 1) is a gene implicated in hereditary retinal diseases, especially in forms of retinitis pigmentosa and Leber congenital amaurosis. The CRB1 protein plays a critical role in maintaining the structure and function of photoreceptor cells in the retina. Research has shown that mutations in the CRB1 gene can lead to severe visual impairments due to the degeneration of these photoreceptors. To better understand the molecular mechanisms underlying these diseases, scientists have focused on the characterization of recombinant CRB1 protein. This involves expressing and purifying CRB1 in laboratory settings to study its biochemical properties, interactions with other proteins, and its functional role in retinal physiology. Additionally, recombinant CRB1 protein serves as a valuable tool for developing potential therapeutic strategies, such as gene therapy or protein replacement therapies aimed at restoring normal function in retinal cells affected by CRB1 mutations. Furthermore, studying the recombinant form of this protein provides insights into its involvement in cell signaling pathways and cellular architecture within the retina, ultimately aiding in the design of targeted interventions for CRB1-related retinal disorders. The ongoing research in this area is crucial for advancing our understanding of retinal degeneration and for the development of innovative treatments to mitigate the impact of CRB1 mutations on visual health.
