Analytical Data
-
Gene name
TIGIT
- Application
-
Alternative Names
TIGIT;VSIG9;VSTM3;T-cell immunoreceptor with Ig and ITIM domains
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q495A1
-
Expression Region
22-141aa
-
AA Sequence
MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNA DLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGR IFLEVLESSVAEHGARFQIP
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIGIT (T cell immunoreceptor with Ig and ITIM domains) is an immune checkpoint receptor primarily expressed on T cells and natural killer (NK) cells. It plays a critical role in regulating immune responses and maintaining self-tolerance by inhibiting T cell activation and promoting immunosuppressive environments, particularly in cancer and chronic infections. The study of TIGIT has gained significant attention due to its potential as a therapeutic target in cancer immunotherapy. In tumors, TIGIT can be upregulated, leading to immune evasion and diminished anti-tumor activity. Research into TIGIT has revealed that it interacts with its ligands, such as CD155 and CD112, which are often overexpressed in tumor microenvironments. This receptor-ligand interaction triggers inhibitory signaling pathways that dampen the immune response. Consequently, the development of TIGIT as a recombinant protein for therapeutic applications is being explored to block its inhibitory function, thereby reinvigorating T cell and NK cell activity against tumors. Various studies are underway to assess the efficacy and safety of TIGIT-targeted therapies, either as monotherapies or in combination with existing immune checkpoint inhibitors like PD-1/PD-L1 therapies. These investigations are crucial in advancing our understanding of TIGIT's role in immune regulation and its potential to enhance anti-tumor immunity, making it a promising candidate in the evolving landscape of cancer immunotherapy.











