Analytical Data
-
Gene name
SLC12A2
- Application
-
Alternative Names
Basolateral Na-K-Cl symporter; BSC; BSC2; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1; mBSC2; MGC104233; NKCC1; PPP1R141; Protein phosphatase 1; regulatory subunit 141; S12A2_HUMAN; Slc12a2; sodium-potassium-chloride cotransporter 1; Solute carrier family 12 (sodium/potassium/chloride transporter); member 2; solute carrier family 12 (sodium/potassium/chloride transporters) member 2; Solute carrier family 12 member 2; sy-ns
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55011
-
Expression Region
903-1010 aa
-
AA Sequence
YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE
-
Molecular Weight
37.62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC12A2, also known as the Solute Carrier Family 12 Member 2, is a key protein involved in the transport of ions across cell membranes, particularly sodium and potassium ions, which are essential for various physiological processes, including cell volume regulation and neuronal excitability. Research on SLC12A2 is critical due to its role in maintaining electrolyte balance and its involvement in several pathophysiological conditions, such as hypertension, kidney disorders, and neurological diseases. Recent advances in recombinant protein technology have facilitated the expression and purification of SLC12A2, allowing scientists to investigate its structural and functional properties in greater detail. By producing this protein in a recombinant form, researchers can study its transport mechanisms and substrate specificity, enabling a better understanding of its physiological roles and potential therapeutic targets. Furthermore, the exploration of SLC12A2's interactions with other proteins and signaling pathways could unveil novel insights into its contribution to cellular homeostasis and disease processes. Overall, the study of SLC12A2 recombinant protein is pivotal for advancing our knowledge of ion transport mechanisms and developing targeted strategies for the treatment of related disorders.
