Analytical Data
-
Gene name
LYPD6
- Application
-
Alternative Names
LYPD6；Ly6/PLAUR domain-containing Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86Y78
-
Expression Region
23-171aa
-
AA Sequence
AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML
-
Molecular Weight
18.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LYPD6, or Ly6/Plaur Domain-Containing 6, is a member of the Ly6/uPAR superfamily, known for its role in cell signaling and adhesion. Recent studies have indicated that LYPD6 may play a crucial role in various physiological processes, particularly in the nervous system and immune responses. Its expression patterns suggest involvement in neurodevelopment and neuronal regeneration, making it a potential target for therapeutic applications in neurodegenerative diseases. Moreover, emerging evidence highlights its involvement in the regulation of inflammation and immune cell signaling, indicating a broader immunological significance. The recombinant expression of LYPD6 is essential for further understanding its structure-function relationships and biological mechanisms. Researchers have been focusing on developing efficient recombinant protein expression systems to produce LYPD6 for functional assays and structural studies. This, in turn, may provide insights into its interactions with other proteins and its role in disease pathogenesis. Overall, the study of LYPD6 as a recombinant protein is a promising area of research that could lead to advancements in therapeutic strategies for neurological and immunological disorders.
