Analytical Data
-
Gene name
TNFRSF17
- Application
-
Alternative Names
TNFRSF17；BCM；BCMA；Tumor necrosis factor receptor superfamily member 17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02223
-
Expression Region
5-54aa
-
AA Sequence
AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
-
Molecular Weight
5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF17, also known as BCMA (B-cell maturation antigen), is a member of the tumor necrosis factor receptor superfamily that plays a crucial role in B cell development and survival. It has gained significant attention in recent years due to its pivotal role in multiple myeloma and other B-cell malignancies. BCMA is predominantly expressed on terminally differentiated plasma cells and has been implicated in promoting cell proliferation, survival, and immune regulation. The development of BCMA-targeted therapies, including monoclonal antibodies and CAR-T cell therapies, has revolutionized the treatment landscape for multiple myeloma, leading to remarkable clinical outcomes. To facilitate these therapeutic approaches, the production and characterization of recombinant TNFRSF17 proteins are vital for understanding the receptor's structure, function, and interaction with ligands, as well as for identifying potential biomarkers for patient stratification. Furthermore, these recombinant proteins can serve as tools for drug development, enabling the screening of new therapeutic candidates and the exploration of mechanistic insights in BCMA-mediated signaling pathways. Thus, the research on TNFRSF17 recombinant proteins is essential for advancing both fundamental science and clinical applications in the context of B-cell-related diseases.
