Analytical Data
-
Gene name
CPLX3
- Application
-
Alternative Names
CPLX3; Nbla11589Complexin-3; Complexin III; CPX III
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVH0
-
Expression Region
1-158aa
-
AA Sequence
MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CPLX3, or Complexin-3, is a critical protein involved in the regulation of synaptic transmission and neurotransmitter release in the nervous system. As a member of the Complexin family, CPLX3 acts as a molecular chaperone that modulates the function of SNARE proteins, which are essential for the fusion of synaptic vesicles with the presynaptic membrane. Dysregulation of CPLX3 has been implicated in various neurological disorders, making it a significant focus of research in neurobiology. Studies have shown that CPLX3 enhances the speed and efficiency of synaptic transmission, suggesting its potential role in learning and memory processes. The recombinant expression of CPLX3 allows researchers to investigate its functional properties, interact with other synaptic proteins, and elucidate its impact on neuronal communication. Understanding CPLX3's structure and function may provide insights into the mechanisms underlying synaptic plasticity and the development of therapeutic strategies for synaptic dysfunction-related diseases. Overall, the study of CPLX3 and its recombinant protein variants offers promising avenues for advancing our comprehension of synaptic mechanisms and their implications in neurodevelopmental and neurodegenerative disorders.
