Analytical Data
-
Gene name
SLC10A6
- Application
-
Alternative Names
MGC129575; MGC129576; Slc10a6; SOAT; SOAT_HUMAN; Sodium dependent organic anion transporter; Sodium-dependent organic anion transporter; Solute carrier family 10 member 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3KNW5
-
Expression Region
1-377 aa
-
AA Sequence
MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWSHIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAVAGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTAEHLVQMLSFPLAYGLFQLIDGFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE
-
Molecular Weight
67.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC10A6, a member of the solute carrier family 10, encodes a protein primarily involved in the transport of small solutes across cell membranes. It plays a critical role in the reuptake of bile acids, neurotransmitters, and other vital molecules, influencing various physiological processes including lipid metabolism and signal transduction. The study of SLC10A6 has gained attention due to its potential implications in metabolic disorders and certain diseases, such as diabetes and liver dysfunction. Moreover, understanding the structure and function of SLC10A6 can provide insights into its regulatory mechanisms and interactions with other proteins, which may lead to the identification of novel therapeutic targets. Recombinant SLC10A6 protein is essential for detailed biochemical analyses, including transport assays and structural characterization, enabling researchers to explore its functional properties and pathophysiological relevance. Through reconstitution studies and advanced biophysical techniques, the functional characterization of SLC10A6 can elucidate its substrate specificity and kinetics, contributing to the broader understanding of solute transporters in health and disease.
