Analytical Data
-
Gene name
isdA
- Application
-
Alternative Names
isdA;frpA;stbA;Iron-regulated surface determinant Protein A
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6GA85
-
Expression Region
47-316aa
-
AA Sequence
ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVSTDTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKHNETPKQASKAKELPKT
-
Molecular Weight
35.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IsdA (iron-regulated surface determinant A) is a significant protein found in certain pathogenic strains of Staphylococcus aureus, primarily recognized for its role in iron acquisition, which is critical for bacterial survival and virulence. Research into IsdA has gained considerable attention due to the pathogen's capacity to cause a variety of serious infections, including skin and soft tissue infections, pneumonia, and bloodstream infections. IsdA is characterized by its ability to bind heme, a complex iron-containing molecule, allowing the bacteria to sequester iron from the host's hemoglobin and other heme sources. This mechanism is particularly crucial given that mammals tightly regulate iron levels as a defense strategy against infections. Understanding the structure and function of IsdA not only provides insights into its role in the pathogenicity of Staphylococcus aureus but also offers potential avenues for the development of novel therapeutic interventions aimed at disrupting iron acquisition pathways in bacteria. As antibiotic resistance among Staphylococcus aureus strains continues to rise, targeting IsdA and similar proteins may represent a promising strategy in developing new antimicrobial agents or vaccines, enhancing our ability to combat bacterial infections effectively. Therefore, research on IsdA and its recombinant forms is pivotal in microbiology and infectious disease fields, contributing to the broader understanding of bacterial physiology and the ongoing quest for innovative treatment options.











