Analytical Data
-
Gene name
RHOA
- Application
-
Alternative Names
RHOA;ARH12;ARHA;RHO12;Transforming Protein RhoA
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61586
-
Expression Region
1-190aa
-
AA Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGC
-
Molecular Weight
23kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RHOA (Ras homolog family member A) is a small GTPase that plays a critical role in various cellular functions, including cytoskeletal dynamics, cell migration, and proliferation. Dysregulation of RHOA has been implicated in several diseases, including cancer and cardiovascular disorders, making it a significant target for therapeutic intervention. The recombinant expression of RHOA proteins allows for detailed studies of their biochemical properties and functional roles within cellular contexts. Researchers have developed various expression systems, such as bacteria, yeast, and mammalian cells, to produce RHOA proteins in sufficient quantities and with the necessary post-translational modifications. Understanding the mechanisms by which RHOA regulates cellular processes can provide insights into its role in disease pathology and help identify potential drug targets. The ongoing research into RHOA and its signaling pathways highlights the importance of these recombinant proteins in dissecting complex cellular networks and validating therapeutic strategies aimed at modulating RHOA activity for beneficial clinical outcomes.











