Analytical Data
-
Gene name
COX8A
- Application
-
Alternative Names
COX; COX8; COX8-2; COX8A; COX8A_HUMAN; COX8L; Cytochrome c oxidase polypeptide VIII-liver/heart; Cytochrome c oxidase subunit 8-2; Cytochrome c oxidase subunit 8A (ubiquitous); Cytochrome c oxidase subunit 8A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10176
-
Expression Region
1-69aa
-
AA Sequence
MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The COX8A gene encodes a subunit of cytochrome c oxidase, which is a crucial component of the mitochondrial respiratory chain, playing a pivotal role in cellular energy production through oxidative phosphorylation. Research on COX8A has garnered attention due to its implications in various metabolic disorders and mitochondrial diseases, where altered mitochondrial function can lead to a range of clinical manifestations. Understanding the structure and function of the COX8A protein is essential for elucidating its role in electron transport and energy metabolism. Recombinant COX8A protein has been generated to facilitate in vitro studies, allowing researchers to investigate its biochemical properties, interaction with other mitochondrial components, and potential regulatory mechanisms. Additionally, exploring variants of COX8A may provide insights into genetic predispositions to mitochondrial dysfunction and associated diseases. Overall, studying COX8A through recombinant protein techniques not only enhances our fundamental knowledge of mitochondrial biology but also paves the way for potential therapeutic strategies targeting mitochondrial-related diseases.
