Analytical Data
-
Gene name
SLC10A4
- Application
-
Alternative Names
SLC10A4; Sodium/bile acid cotransporter 4; Na(+)/bile acid cotransporter 4; Solute carrier family 10 member 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96EP9
-
Expression Region
1-437 aa
-
AA Sequence
MDGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLGPGPSFGFSPGPTPTPEPTTSGLAGGAASHGPSPFPRPWAPHALPFWDTPLNHGLNVFVGAALCITMLGLGCTVDVNHFGAHVRRPVGALLAALCQFGLLPLLAFLLALAFKLDEVAAVAVLLCGCCPGGNLSNLMSLLVDGDMNLSIIMTISSTLLALVLMPLCLWIYSWAWINTPIVQLLPLGTVTLTLCSTLIPIGLGVFIRYKYSRVADYIVKVSLWSLLVTLVVLFIMTGTMLGPELLASIPAAVYVIAIFMPLAGYASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTSL
-
Molecular Weight
72.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC10A4, a member of the solute carrier family, encodes a sodium-dependent transporter involved in the uptake of various substrates, including neurotransmitters and other small molecules. Its significance in physiological processes, particularly in the central nervous system and peripheral tissues, has garnered attention due to its potential roles in neurotransmission and metabolic regulation. Dysregulation of SLC10A4 has been associated with various neurological disorders, making it a target of interest for understanding its biological functions and implications in health and disease. Research on recombinant SLC10A4 protein is crucial for elucidating its structure-function relationship, substrate specificity, and regulatory mechanisms. Recombinant expressions facilitate the production of adequate protein quantities for in vitro studies, enabling the investigation of its transport kinetics and interactions with other proteins or drugs. Understanding SLC10A4's functional dynamics can provide insights into therapeutic strategies for related disorders and contribute to a broader understanding of transporter biology. Thus, the study of SLC10A4 not only enhances our knowledge of its role in cellular transport mechanisms but also lays the groundwork for exploring its therapeutic potential in treating conditions linked to its dysregulation.
