Cat: PA1000-7582

Recombinant mouse CSF1R Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CSF1R

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CSF1R;FMS;Macrophage colony-stimulating factor 1 receptor

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09581

  • Expression Region

    20-511aa

  • AA Sequence

    APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTL TTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVE GQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKV LDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEA AQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVD FQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSL ILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRV KASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDV SGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQ LPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

  • Molecular Weight

    81 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CSF1R (Colony Stimulating Factor 1 Receptor) is a vital receptor protein that plays a significant role in regulating the survival, proliferation, and differentiation of monocytes and macrophages, which are crucial components of the immune system. Dysregulation of CSF1R signaling has been implicated in various pathologies, including cancer, where tumor-associated macrophages can promote tumor growth and metastasis. Consequently, CSF1R has emerged as a promising target for therapeutic interventions. Researchers have been focusing on the characterization and development of recombinant CSF1R proteins to better understand its biological functions and to explore its potential as a drug target. The design of these recombinant proteins involves the use of advanced molecular biology techniques to produce functional proteins that can mimic natural CSF1R. These studies aim not only to elucidate the signaling pathways associated with CSF1R but also to assess the efficacy of novel inhibitors that could disrupt its function in tumor microenvironments. The ongoing research seeks to provide insights into how modulating CSF1R activity could enhance anti-tumor immune responses and lead to innovative treatments for various cancers, thereby highlighting the importance of CSF1R recombinant proteins in both basic and applied biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US