Analytical Data
-
Gene name
Tafa1
- Application
-
Alternative Names
Tafa1；FAM19A1；Chemokine-like Protein TAFA-1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7TPG8
-
Expression Region
20-133aa
-
AA Sequence
MLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT
-
Molecular Weight
20.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tafa1, a member of the TGF-beta superfamily, has garnered significant attention in recent years due to its crucial role in various biological processes, including immune response modulation, cell differentiation, and tissue repair. Research has indicated that Tafa1 is involved in the regulation of inflammatory responses and may play a vital role in mediating the effects of certain autoimmune diseases. The recombinant expression of Tafa1 protein offers a promising avenue for investigating its functional mechanisms, facilitating the development of potential therapeutic interventions. By studying the recombinant Tafa1, researchers aim to elucidate its signaling pathways, interactions with other biomolecules, and downstream effects on cellular behavior. Additionally, understanding the structure-function relationship of Tafa1 can aid in the design of targeted therapies aimed at modulating its activity in pathological conditions. The production of Tafa1 as a recombinant protein enables high-throughput studies and provides a platform for screening potential inhibitors or activators, ultimately contributing to its relevance in biomedicine and therapeutic development.
