Analytical Data
-
Gene name
Scgb1c1
- Application
-
Alternative Names
Scgb1c1；Secretoglobin family 1C member 1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7M742
-
Expression Region
24-95aa
-
AA Sequence
EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT
-
Molecular Weight
21.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Scgb1c1, also known as secretoglobin family 1C member 1, is a protein that belongs to the secretoglobin family, which comprises a group of small, secreted proteins characterized by their role in modulating various physiological processes. Primarily found in the respiratory system, Scgb1c1 is produced by Clara cells in the airways and plays a crucial role in lung homeostasis, inflammation, and repair mechanisms. Research has shown that Scgb1c1 can act as an anti-inflammatory mediator and a protector against oxidative stress, making it a significant focus in studies related to respiratory diseases such as asthma and chronic obstructive pulmonary disease (COPD). Additionally, abnormalities in Scgb1c1 expression have been linked to lung tumorigenesis, highlighting its potential as a biomarker for early detection of lung cancer. The recombinant production of Scgb1c1 protein has gained attention due to its applications in understanding the protein's structure-function relationship, optimizing therapeutic strategies, and developing diagnostic tools. By exploring the biochemical properties and biological activities of recombinant Scgb1c1, researchers aim to elucidate its mechanisms of action and assess its potential as a target for innovative treatments in respiratory pathologies.
