Analytical Data
-
Gene name
SKP1A
- Application
-
Alternative Names
Cyclin A/CDK2 associated p19; Cyclin A/CDK2 associated protein p19; Cyclin-A/CDK2-associated protein p19; EMC19; MGC34403; OCP 2; OCP II; OCP II protein; OCP-2; OCP-II; OCP2; OCPII; Organ of Corti protein 2; Organ of Corti protein II; OTTHUMP00000159379; OTTHUMP00000159380; OTTHUMP00000228275; OTTHUMP00000228276; OTTHUMP00000228278; OTTHUMP00000228279; OTTHUMP00000228281; p19A; p19skp1; RNA polymerase II elongation factor like protein; RNA polymerase II elongation factor like protein OCP2; RNA polymerase II elongation factor-like protein; S phase kinase associated protein 1; S phase kinase associated protein 1A; S phase kinase associated protein 1A p19A; S-phase kinase-associated protein 1; SIII; Skp 1; SKP 1A; skp1; SKP1_HUMAN; SKP1A; TCEB1L; Transcription Elongation Factor B 1 like; Transcription elongation factor B; Transcription elongation factor B SIII polypeptide 1 like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P63208
-
Expression Region
2-163 aa
-
AA Sequence
PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
-
Molecular Weight
45.5kDa kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SKP1A is a critical component of the Skp1-Cullin-F-box (SCF) ubiquitin ligase complex, which plays a vital role in the ubiquitin-proteasome pathway responsible for protein degradation and regulation of cellular processes. This protein is essential for mediating the interaction between F-box proteins and the Cullin-RING complex, thus facilitating the ubiquitylation of target substrates. Research into SKP1A has gained prominence due to its implications in various cellular functions, including cell cycle regulation, signal transduction, and responses to stress. Dysregulation of the SCF complex, and consequently SKP1A, has been linked to numerous diseases, including cancer and neurodegenerative disorders. Understanding the structure, function, and interactions of SKP1A can provide insights into its role in disease mechanisms and identify potential therapeutic targets. Moreover, the recombinant expression and purification of SKP1A are crucial for structural studies and the development of inhibitors that can modulate its function in pathological conditions. Investigating SKP1A offers a pathway to unraveling the complexities of protein homeostasis and cellular signaling networks, leading to advancements in targeted therapies for diseases associated with proteostasis imbalance.











