Analytical Data
-
Gene name
COX4I2
- Application
-
Alternative Names
AL024441; COX 4; COX IV 1; COX IV; COX IV-1; Cox4; COX41_HUMAN; Cox4a; COX4B; COX4I1; COX4I2; COX4L2; COXIV; Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit 4 isoform 1 mitochondrial; Cytochrome c oxidase subunit 4 isoform 1. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13073
-
Expression Region
23-169aa
-
AA Sequence
AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
-
Molecular Weight
33.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX4I2 is a nuclear-encoded subunit of cytochrome c oxidase (CcO), the terminal enzyme of the mitochondrial electron transport chain, which plays a critical role in cellular respiration and energy production. Research into COX4I2 has garnered interest due to its implications in various physiological and pathological processes. Unlike its counterpart COX4I1, COX4I2 is particularly expressed in various tissues and is thought to be involved in the adaptation of cells to fluctuating oxygen levels, a process crucial for maintaining cellular homeostasis and supporting metabolic demands. Studies have shown that COX4I2 expression can influence mitochondrial function, thereby affecting overall cellular energy metabolism and survival under stress conditions. Moreover, aberrations in COX4I2 expression have been linked to several diseases, including cancer and neurodegenerative disorders, highlighting its potential role as a biomarker or therapeutic target. Given its importance in mitochondrial bioenergetics and disease pathology, the recombinant expression and characterization of COX4I2 provide valuable insights into its structural properties and functional mechanisms. This research could facilitate the development of innovative strategies for therapeutic intervention in diseases associated with mitochondrial dysfunction, making COX4I2 a significant focus in contemporary biomedical research.
