Analytical Data
-
Gene name
TNFRSF10A
- Application
-
Alternative Names
TNFRSF10A;APO2;DR4;TRAILR1;Tumor necrosis factor receptor superfamily member 10A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00220
-
Expression Region
110-239aa
-
AA Sequence
TIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASN NLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSR GCPRGMVKVKDCTPWSDIECVHKESGNGHN
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tumor necrosis factor receptor superfamily member 10A (TNFRSF10A), also known as death receptor 4 (DR4), plays a pivotal role in regulating apoptosis and immune responses. It is primarily recognized for its ability to bind to the ligand TRAIL (TNF-related apoptosis-inducing ligand), triggering apoptotic pathways in certain cancer cells, which has garnered interest in its potential therapeutic applications in cancer treatment. The distinctive mechanism of TRAIL-induced apoptosis presents an opportunity for targeted therapies that minimize damage to normal tissues. Studies have shown that the expression of TNFRSF10A is often correlated with increased sensitivity to TRAIL, making this receptor a focus for enhancing anti-tumor efficacy. However, the clinical application of TRAIL and its receptors has been hindered by issues like resistance in some tumor types and the complexity of apoptotic signaling pathways. As such, the production of recombinant TNFRSF10A protein is crucial for both understanding its structural and functional properties and for developing novel therapeutic strategies. Moreover, recombinant TNFRSF10A can be utilized in drug development, functional assays, and the exploration of combinations with other therapeutic agents. Understanding the dynamics of TNFRSF10A interactions and its downstream signaling mechanisms can lead to innovative approaches in cancer therapy, positioning it as a vital target in the ongoing quest for more effective and selective cancer treatments. The continued research surrounding TNFRSF10A, including its recombinant expression, holds promise for advancing both basic cancer biology and clinical oncology.











