Cat: PA1000-7401

Recombinant Human IRAK4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IRAK4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IRAK4;Interleukin-1 receptor-associated kinase 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NWZ3

  • Expression Region

    104-460aa

  • AA Sequence

    AVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSP ENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKG YVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSS DGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLH ENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTA YMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEI EDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQL LQEMTAS

  • Molecular Weight

    52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IRAK4 (Interleukin-1 receptor-associated kinase 4) is a critical component of the innate immune response, playing a pivotal role in the signaling pathways activated by pro-inflammatory cytokines, particularly interleukin-1 (IL-1) and toll-like receptors (TLRs). This kinase is essential for mediating downstream signaling events that lead to the activation of NF-kB and MAPK pathways, which are crucial for producing pro-inflammatory cytokines and other immune responses. Dysregulation of IRAK4 has been implicated in various inflammatory diseases, autoimmune disorders, and certain cancers, marking it as a significant target for therapeutic intervention. The study of IRAK4 recombinant proteins has emerged as a key area in immunology, enabling researchers to explore its structure-function relationships, post-translational modifications, and interactions with other signaling molecules. Furthermore, the development of IRAK4 inhibitors promises novel approaches for treating conditions associated with excessive inflammation. Understanding the biochemical properties and regulatory mechanisms of IRAK4 through recombinant protein studies could provide insights into its role in immune signaling and aid in the identification of new strategies for modulating immune responses in disease contexts. Consequently, IRAK4 remains a prime candidate for drug development, with ongoing research aimed at elucidating its functional dynamics within the immune system.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US