Cat: PA1000-7399

Recombinant Human SRC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SRC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SRC;SRC1;Proto-oncogene tyrosine-Protein kinase Src

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12931

  • Expression Region

    2-536aa

  • AA Sequence

    MHHHHHHGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASA DGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYD YESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDF DNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL TTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYM SKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAAN ILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTI KSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESL HDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

  • Molecular Weight

    61 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SRC (Avian Sarcoma Viral Oncogene Homolog) is a non-receptor tyrosine kinase that plays a crucial role in various cellular processes, including proliferation, differentiation, and survival. Initially identified as an oncogene in relation to avian sarcoma viruses, SRC has been implicated in several human cancers, highlighting its significance in tumor biology and metastasis. Research on SRC recombinant proteins has gained momentum due to their potential as therapeutic targets and biomarkers. SRC's enzymatic activity is regulated by complex signaling pathways, making it a critical player in cellular communication and response to external stimuli. Understanding the structure and function of SRC through recombinant protein studies can reveal insights into its regulatory mechanisms and interactions with other cellular components. Furthermore, the development of SRC inhibitors has emerged as a promising strategy for cancer treatment, emphasizing the need for detailed studies on its biochemical properties. As SRC is often overexpressed or hyperactivated in cancer cells, targeted therapies aiming to inhibit this kinase hold potential for improving treatment outcomes. Researchers are employing various techniques to produce and characterize SRC recombinant proteins, enabling the exploration of its role in disease pathology and the identification of novel therapeutic approaches. Overall, the study of SRC recombinant proteins is pivotal in advancing our understanding of cancer biology and developing innovative strategies for intervention.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US