Analytical Data
-
Gene name
NXNL2
- Application
-
Alternative Names
NXNL2；C9orf121；Nucleoredoxin-like Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VZ03
-
Expression Region
1-135aa
-
AA Sequence
MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS
-
Molecular Weight
30.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NXNL2, a member of the NIX family, is a naturally occurring protein predominantly expressed in the retinal neural cells. Research into NXNL2 has garnered attention due to its potential implications in retinal health and disease. The protein is known to play a critical role in the maintenance and function of photoreceptors, which are essential for vision. Mutations or dysregulation of NXNL2 have been linked to various retinal disorders, including retinitis pigmentosa and age-related macular degeneration, conditions that lead to progressive vision loss. Furthermore, NXNL2 is implicated in the protective mechanisms against oxidative stress and inflammation within the retinal environment. Given the increasing prevalence of retinal diseases and their profound impact on quality of life, understanding the function and therapeutic potential of NXNL2 is crucial. Recent advances in molecular biology techniques have enabled the recombinant expression of NXNL2, allowing for detailed biochemical characterization and exploration of its functional properties. This research not only enhances our understanding of NXNL2's role in retinal biology but also opens up avenues for developing novel strategies aimed at the treatment or prevention of retinal diseases associated with this protein.
