Cat: PA2000-6778

Recombinant Human COA5 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COA5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COA5; C2orf64Cytochrome c oxidase assembly factor 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86WW8

  • Expression Region

    1-74aa

  • AA Sequence

    MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY

  • Molecular Weight

    8.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COA5 (CoA biosynthesis factor 5) is a mitochondrial protein that plays a critical role in the biosynthesis of coenzyme A (CoA), an essential cofactor involved in various metabolic processes, including fatty acid oxidation, the Krebs cycle, and the synthesis of certain neurotransmitters. Dysfunction in COA5 has been linked to a rare autosomal recessive disorder characterized by neurological impairments, developmental delays, and metabolic disturbances. Research on COA5 has gained significant attention due to its involvement in mitochondrial function and energy metabolism, as well as its potential implications in broader metabolic diseases. Recent studies have revealed that mutations in the COA5 gene can lead to a reduction in CoA levels, affecting cellular energy production and resulting in various pathological symptoms. Understanding the molecular mechanisms underlying COA5 function and its role in CoA biosynthesis is crucial for developing therapeutic strategies targeting related metabolic disorders. Additionally, the exploration of recombinant COA5 protein may provide insights into its structural and functional characteristics, paving the way for potential interventions in conditions arising from its deficiency. As the field of mitochondrial research continues to evolve, the investigation of COA5 and its implications for human health is of paramount importance, promising to elucidate the complexities of metabolic pathways and their connections to various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US