Analytical Data
-
Gene name
COA5
- Application
-
Alternative Names
COA5; C2orf64Cytochrome c oxidase assembly factor 5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86WW8
-
Expression Region
1-74aa
-
AA Sequence
MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY
-
Molecular Weight
8.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COA5 (CoA biosynthesis factor 5) is a mitochondrial protein that plays a critical role in the biosynthesis of coenzyme A (CoA), an essential cofactor involved in various metabolic processes, including fatty acid oxidation, the Krebs cycle, and the synthesis of certain neurotransmitters. Dysfunction in COA5 has been linked to a rare autosomal recessive disorder characterized by neurological impairments, developmental delays, and metabolic disturbances. Research on COA5 has gained significant attention due to its involvement in mitochondrial function and energy metabolism, as well as its potential implications in broader metabolic diseases. Recent studies have revealed that mutations in the COA5 gene can lead to a reduction in CoA levels, affecting cellular energy production and resulting in various pathological symptoms. Understanding the molecular mechanisms underlying COA5 function and its role in CoA biosynthesis is crucial for developing therapeutic strategies targeting related metabolic disorders. Additionally, the exploration of recombinant COA5 protein may provide insights into its structural and functional characteristics, paving the way for potential interventions in conditions arising from its deficiency. As the field of mitochondrial research continues to evolve, the investigation of COA5 and its implications for human health is of paramount importance, promising to elucidate the complexities of metabolic pathways and their connections to various diseases.











