Analytical Data
-
Gene name
SGCG
- Application
-
Alternative Names
35 kDa dystrophin associated glycoprotein; 35 kDa dystrophin-associated glycoprotein; 35DAG; 35kD dystrophin associated glycoprotein; 35kDa dystrophin-associated glycoprotein; A4; DAGA4; DMDA; DMDA1; Gamma SG; Gamma-sarcoglycan; Gamma-SG; LGMD2C; MAM ; MGC130048; Sarcoglycan gamma; SCARMD2; SCG3; SGCG; SGCG_HUMAN; TYPE
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13326
-
Expression Region
1-291 aa
-
AA Sequence
MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL
-
Molecular Weight
58.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SGCG, or sarcoglycan gamma, is a crucial component of the dystrophin-glycoprotein complex, which plays a vital role in maintaining the structural integrity of muscle cells. Mutations in the SGCG gene are associated with limb-girdle muscular dystrophy type 2C (LGMD2C), a genetic disorder that leads to progressive muscle weakness and degeneration. Research on SGCG recombinant proteins has emerged to better understand its function, the molecular mechanisms underlying its role in muscle integrity, and the pathophysiology of associated muscular dystrophies. The development of SGCG recombinant proteins facilitates the exploration of potential therapeutic approaches, including gene therapy and protein replacement strategies, aimed at restoring the function of defective proteins in patients. Moreover, these recombinant proteins serve as valuable tools for studying the interactions within the dystrophin-glycoprotein complex and evaluating the efficacy of novel treatments. As the knowledge surrounding SGCG continues to expand, it holds promise for advancing our understanding of muscular dystrophies and developing targeted interventions that could improve patient outcomes. This research is crucial not only for identifying potential biomarkers for LGMD2C but also for designing effective therapeutic strategies that could ameliorate the symptoms associated with the disease, ultimately enhancing the quality of life for affected individuals.
