Cat: PA1000-7351

Recombinant Human RET Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RET

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RET;CDHF12;CDHR16;PTC;Proto-oncogene tyrosine-Protein kinase receptor Ret

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07949

  • Expression Region

    658-1114aa

  • AA Sequence

    HCYHKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVD AFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAV KMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYA KYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQ ISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVK RSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPP ERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEK MMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWI ENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWMLSPSAAK LMDTFDS

  • Molecular Weight

    74 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RET (REarranged during Transfection) protein is a receptor tyrosine kinase that plays a critical role in various cellular processes, including cell differentiation, proliferation, and survival. Initially identified as a proto-oncogene implicated in certain cancers, such as multiple endocrine neoplasia type 2 (MEN2), RET has garnered significant attention due to its involvement in neurodevelopmental pathways, particularly in the formation of the enteric nervous system and the development of certain types of neural crest-derived tissues. Mutations and rearrangements in the RET gene can lead to aberrant signaling pathways, contributing to oncogenesis in several tumor types, including medullary thyroid carcinoma and papillary thyroid carcinoma. Consequently, the study of RET and its synthesized recombinant proteins has become a focus for researchers aiming to develop targeted therapies and diagnostic tools. Creating recombinant RET proteins has advanced our understanding of its structure-function relationships, ligand interactions, and downstream signaling mechanisms. Moreover, RET has emerged as a promising therapeutic target, with small molecule inhibitors showing potential in cancer treatment, thus underscoring the importance of ongoing research into the biology of RET and its implications in both health and disease. Understanding RET's mechanisms will ultimately aid in designing more effective interventions for RET-related malignancies and improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US