Analytical Data
-
Gene name
CT83
- Application
-
Alternative Names
CT83；C20orf129；Protein FAM83D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5H943
-
Expression Region
1-113aa
-
AA Sequence
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
-
Molecular Weight
14.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CT83, also known as NY-ESO-1, is a cancer/testis (CT) antigen that has gained significant attention in cancer immunotherapy research due to its unique expression profile. CT83 is primarily expressed in various malignant tumors, including melanoma and certain types of sarcomas, while being largely restricted to the testis in normal tissues, making it an attractive target for tumor-specific immune responses. The immune system often fails to recognize tumors because cancer cells can evade detection. However, CT83's restricted expression allows for the potential development of targeted therapies that could stimulate the immune response specifically against cancer cells expressing this antigen. Recent studies have explored CT83's role in T-cell activation and its ability to serve as a biomarker for cancer progression. Recombining CT83 protein for use in vaccines or other therapeutic modalities has shown promise in preclinical and clinical settings, enhancing anti-tumor immunity. Ongoing research aims to optimize the presentation of CT83 to immune cells to improve treatment efficacy and minimize off-target effects, further establishing CT83 as a pivotal player in the landscape of personalized cancer immunotherapy.
