Analytical Data
-
Gene name
WDR38
- Application
-
Alternative Names
WDR38；WD repeat-containing Protein 38
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5JTN6
-
Expression Region
1-314aa
-
AA Sequence
MNSGVPATLAVRRVKFFGQHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCYSASGLLASGSWDKTIHIWKPTTSSLLIQLKGHVTWVKSIAFSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHTCAFTPDGKILVSGAADQTRRQISRTSKSPRDPQT
-
Molecular Weight
61.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WDR38 (WD repeat domain 38) is a protein that belongs to the WD40-repeat protein family, which is implicated in various cellular processes, including cell signaling, gene expression regulation, and protein-protein interactions. The study of WDR38 has garnered attention due to its potential roles in cell proliferation and differentiation, as well as in various diseases, including cancer and developmental disorders. Research has indicated that WDR38 may interact with multiple signaling pathways, including those involving major regulatory proteins like cyclins and phosphatases. Despite its importance, the precise biological functions of WDR38 are not yet fully understood, and detailed analyses of its structure and interactions are necessary for elucidating its roles in cellular mechanisms. Recombinant WDR38 protein has been produced and characterized to facilitate studies on its function and interactions, enabling researchers to investigate its potential as a therapeutic target or biomarker in disease contexts. Understanding the molecular mechanisms through which WDR38 operates could provide insights into its contributions to physiological and pathological processes, ultimately aiding in the development of novel strategies for intervention in related health conditions.
