Analytical Data
-
Gene name
SFRS7
- Application
-
Alternative Names
Serine/arginine-rich splicing factor 7. Splicing factor 9G8. Splicing factor. arginine/serine-rich 7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16629
-
Expression Region
1-238 aa
-
AA Sequence
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
-
Molecular Weight
53.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFRS7, or Serine/Arginine-rich splicing factor 7, is a member of the SR protein family, which plays a critical role in the regulation of pre-mRNA splicing. This protein is involved in the splicing process that modifies pre-mRNA into mature mRNA, ultimately influencing gene expression and protein diversity. The interest in SFRS7 has grown due to its potential implications in various biological processes and diseases, including cancer and neurodegenerative disorders. Abnormal expression or mutation of splicing factors like SFRS7 can lead to misregulation of splicing events, resulting in the production of aberrant proteins that may contribute to pathophysiology. Recent studies have indicated that SFRS7 might also interact with other proteins and RNA molecules, suggesting a complex network of regulatory pathways. Understanding the structure and function of SFRS7, along with its role in splicing and other cellular activities, is crucial for elucidating its contributions to health and disease. Consequently, research into the recombinant expression and characterization of SFRS7 is vital for exploring its biological functions and therapeutic potential, paving the way for new strategies for diagnosis and treatment of diseases associated with splicing dysregulation.
