Analytical Data
-
Gene name
STK24
- Application
-
Alternative Names
STK24；MST3；STK3；Serine/threonine-Protein kinase 24
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6E0
-
Expression Region
1-443aa
-
AA Sequence
MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STK24, also known as Serine/Threonine Kinase 24, is a member of the Ste20 family of kinases, which play crucial roles in various cellular processes such as cell growth, differentiation, and apoptosis. Research has increasingly focused on STK24 due to its involvement in critical signaling pathways, particularly those related to stress responses and the regulation of cell motility. Dysregulation of STK24 has been implicated in several diseases, including cancer and cardiovascular disorders, making it a potential therapeutic target. Furthermore, the study of STK24’s structure and function, particularly through the use of recombinant protein techniques, provides insights into its mechanism of action and interactions with other cellular components. By understanding STK24 at the molecular level, researchers aim to elucidate its role in disease pathology and explore its potential as a biomarker or therapeutic intervention point. This makes STK24 an attractive candidate for further investigation in both basic and applied biomedical research, with the goal of developing strategies to modulate its activity for therapeutic benefit.
