Analytical Data
-
Gene name
CNOT1
- Application
-
Alternative Names
CNOT1; CDC39; KIAA1007; NOT1; AD-005CCR4-NOT transcription complex subunit 1; CCR4-associated factor 1; Negative regulator of transcription subunit 1 homolog; NOT1H; hNOT1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A5YKK6
-
Expression Region
2278-2375aa
-
AA Sequence
NSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGA
-
Molecular Weight
36.52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNOT1, a key component of the CCR4-NOT complex, plays a crucial role in various cellular processes, including RNA degradation, gene regulation, and controlling mRNA stability. Understanding the functions of CNOT1 is essential for unraveling the intricacies of post-transcriptional regulation and its implications in health and disease. Research has shown that CNOT1 is involved in tumorigenesis, as its expression levels and activity can influence the cell cycle and apoptosis. The study of recombinant CNOT1 protein has gained prominence in recent years as scientists aim to elucidate its molecular mechanisms and interactions with other proteins and RNA substrates. By producing and characterizing recombinant CNOT1, researchers can investigate its structural properties and functional roles in greater detail. Additionally, utilizing recombinant techniques allows for the manipulation of CNOT1 to develop potential therapeutic strategies targeting its pathways, especially in cancers where its dysregulation is apparent. This research background highlights the importance of thorough investigations of CNOT1 to better understand its significance in cellular function and its potential as a target in therapeutic applications.
