Cat: PA1000-7336

Recombinant Human ADK Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADK

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ADK;Adenosine kinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55263

  • Expression Region

    22-362aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMRENILFGMGNPLLDISAVVDKDFLDKYSL KPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKA ATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRS LIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVA HHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFARE QGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFA VLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRR TGCTFPEKPDFH

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADK (Adenosine Kinase) is an enzyme that plays a crucial role in cellular energy metabolism by catalyzing the phosphorylation of adenosine to adenosine monophosphate (AMP). Abnormal ADK activity has been associated with various pathological conditions, including cancer, neurodegenerative diseases, and metabolic disorders. Recent studies have highlighted the significance of ADK in regulating adenosine levels, which influence processes such as immune response, neuroprotection, and tumor growth. The reconstitution of ADK as a recombinant protein offers a powerful tool for elucidating its structural and functional properties, as well as its interactions with potential inhibitors or substrates. This recombinant approach enables researchers to investigate ADK's enzymatic mechanisms in vitro and assess how modifications in its activity could impact cellular functions and disease. Understanding the nuances of ADK regulation and its implications in health and disease may lead to novel therapeutic strategies targeting ADK for conditions characterized by dysregulated adenosine signaling. Thus, the study of recombinant ADK is essential for revealing the broader biological roles of this enzyme and aiding the development of adenosine-related treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US