Analytical Data
-
Gene name
ARID4B
- Application
-
Alternative Names
ARID4B；RBBP1；RBP1；AT-rich interactive domain-containing Protein 4A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q4LE39
-
Expression Region
167-415aa
-
AA Sequence
KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK
-
Molecular Weight
32.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARID4B (AT-rich interaction domain 4B) is a member of the ARID family of proteins known to play crucial roles in transcriptional regulation, chromatin remodeling, and several cellular processes, including proliferation, differentiation, and apoptosis. Recent studies have highlighted the significance of ARID4B in various cancers, suggesting that its dysregulation may contribute to tumorigenesis and cancer progression. Notably, ARID4B has been implicated in the regulation of genes involved in the cell cycle and DNA repair pathways, drawing attention to its potential as a therapeutic target. Moreover, research has shown that ARID4B can interact with various co-factors and signaling pathways, further complicating its role in cellular functions and disease mechanisms. Investigations into ARID4B's structure, function, and the consequences of its alterations in specific malignancies are ongoing, aiming to elucidate its precise contributions to cancer biology and to identify potential strategies for targeted therapies. The understanding of ARID4B's molecular mechanisms and its interactions within transcriptional complexes could pave the way for novel interventions in ARID4B-associated cancers and enhance our knowledge of its broader biological roles.
