Cat: PA1000-7327

Recombinant Human IHPK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IHPK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IHPK1;IHPK1;KIAA0263;Inositol hexakisphosphate kinase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92551

  • Expression Region

    1-441aa

  • AA Sequence

    MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKP LISREQRFYESLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESE TVEQDDTTEREQPRRKHSRRSLHRSGSGSDHKEEKASLSLETSESSQEAK SPKVELHSHSEVPFQMLDGNSGLSSEKISHNPWSLRCHKQQLSRMRSESK DRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRKCEQ STSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNG LDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRAESCL DRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDF AHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ

  • Molecular Weight

    66 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IHPK1 (Inositol Hexakisphosphate Kinase 1) is an enzyme that plays a crucial role in cellular signaling and metabolism, particularly in the regulation of inositol phosphate levels. Recent studies have highlighted its involvement in various biological processes, including cell proliferation, apoptosis, and the modulation of cellular responses to stress. Given its significance in these pathways, IHPK1 has garnered attention as a potential therapeutic target for diseases such as cancer and metabolic disorders. The recombinant production of IHPK1 enables researchers to investigate its biochemical properties and functional roles in detail. By expressing this protein in suitable systems, such as E. coli or mammalian cells, scientists can obtain sufficient quantities for structural and functional analysis, thus advancing our understanding of its mechanisms of action. Furthermore, studying IHPK1 at the molecular level could reveal novel insights into the signaling pathways it influences, paving the way for the development of targeted therapeutic interventions. Overall, the exploration of IHPK1 recombinant proteins represents a promising avenue for uncovering new paradigms in cell signaling and disease modulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US