Analytical Data
-
Gene name
CNIH
- Application
-
Alternative Names
CNIH1; CNIH; CNIL; UNQ155/PRO181; Protein cornichon homolog 1; CNIH-1; Cornichon family AMPA receptor auxiliary protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95406
-
Expression Region
1-144aa
-
AA Sequence
MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNIH (Cryptochrome and Circadian Regulator Protein Family) recombinant proteins have garnered significant attention in recent years due to their crucial roles in various biological processes, including circadian rhythms, DNA repair, and cellular signaling. These proteins are intrinsically linked to the regulation of biological clocks in organisms, affecting behaviors and physiological responses to environmental changes. Research in this field aims to understand the molecular mechanisms by which CNIH proteins influence circadian rhythms and their implications for health and disease, particularly in conditions like sleep disorders, metabolic syndrome, and cancer. The expression of CNIH as recombinant proteins allows for detailed biochemical analysis, functional studies, and the development of potential therapeutic strategies. As scientists engineer these proteins in the lab, they can elucidate their structures and interactions with other biomolecules, paving the way for novel insights into their roles in cellular homeostasis and the circadian system. Moreover, the therapeutic applications of CNIH proteins, including their potential modulation in treatment avenues for dysregulation of circadian rhythms, highlight the increasing relevance of this research in the field of biomedicine. Thus, understanding CNIH recombinant proteins not only enhances our comprehension of fundamental biological processes but also opens avenues for innovative therapeutic interventions in various health-related issues.
