Analytical Data
-
Gene name
AKAP4
- Application
-
Alternative Names
AKAP4；AKAP82；A-kinase anchor Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5JQC9
-
Expression Region
189-854aa
-
AA Sequence
QSPSAPPAKPPSTQRAVISPDGECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVELTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQVASDMMVSLMKTLKVHSSGKPIPASVVLKRVLLRHTKEIVSDLIDSCMKNLHNITGVLMTDSDFVSAVKRNLFNQWKQNATDIMEAMLKRLVSALIGEEKETKSQSLSYASLKAGSHDPKCRNQSLEFSTMKAEMKERDKGKMKSDPCKSLTSAEKVGEHILKEGLTIWNQKQGNSCKVATKACSNKDEKGEKINASTDSLAKDLIVSALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQANGQFIDKLVESVMKLCLIMAKYSNDGAALAELEEQAASANKPNFRGTRCIHSGAMPQNYQDSLGHEVIVNNQCSTNSLQKQLQAVLQWIAASQFNVPMLYFMGDKDGQLEKLPQVSAKAAEKGYSVGGLLQEVMKFAKERQPDEAVGKVARKQLLDWLLANL
-
Molecular Weight
77.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AKAP4 (A-kinase anchoring protein 4) is a key player in the organization of protein kinase A (PKA) signaling pathways, primarily in the testes, where it is localized to the fibrous sheath of sperm flagella. The study of AKAP4 has gained significance as it is not only crucial for sperm motility and fertility but also linked to several reproductive disorders. Its role as an anchoring protein facilitates the spatial and temporal regulation of PKA and other signaling molecules, allowing precise control of cellular responses. Research on recombinant AKAP4 protein has advanced our understanding of its structure, function, and interaction with other proteins within the signaling cascade. Such studies have utilized techniques like protein expression and purification, followed by functional assays to elucidate its mechanistic role in sperm physiology. Furthermore, the investigation of AKAP4 has been pivotal in exploring potential therapeutic targets for male infertility, making it a subject of growing interest in reproductive biology and medicine. The recombinant expression of AKAP4 allows for detailed studies of its interactions and effects, providing insights into its contribution to sperm function and broader implications for male reproductive health. Understanding AKAP4's molecular mechanisms holds promise not only for enhancing fertility treatments but also for unraveling the complexities of PKA signaling in various biological contexts.
