Analytical Data
-
Gene name
CNIH3
- Application
-
Alternative Names
CNIH3; Protein cornichon homolog 3; CNIH-3; Cornichon family AMPA receptor auxiliary protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBE1
-
Expression Region
1-160aa
-
AA Sequence
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
-
Molecular Weight
43.34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNIH3, or Caprine Neuronal Inhibitory Protein 3, is a member of the CNIH family, which plays a role in modulating neuronal excitability and synaptic transmission. Its significance has been highlighted in various neurological studies, where it is implicated in processes such as synaptic plasticity and the functioning of ion channels. Research on CNIH3 has gained momentum due to its potential involvement in neurodevelopmental disorders and various neurodegenerative diseases. The recombinant protein of CNIH3 allows for detailed biochemical and functional studies that contribute to our understanding of its biological role. By expressing and purifying CNIH3 as a recombinant protein, researchers can investigate its interactions with other proteins, its effects on neurotransmitter signaling, and its potential as a therapeutic target. Understanding the structure-function relationship of CNIH3 through such studies may provide insights into its mechanisms of action and therapeutic efficacy, paving the way for novel approaches in treating neurological conditions. Overall, the research surrounding CNIH3 recombinant protein emphasizes its importance in neuroscience and highlights the broader implications for therapeutic strategies in neurology.
