Analytical Data
-
Gene name
CNIH2
- Application
-
Alternative Names
CNIH2; CNIL; Protein cornichon homolog 2; CNIH-2; Cornichon family AMPA receptor auxiliary protein 2; Cornichon-like protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PI25
-
Expression Region
1-160aa
-
AA Sequence
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
-
Molecular Weight
45.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNIH2 (Cell Adhesion Neuron-Associated Protein 2) is a member of the CNIH family, which plays a significant role in the modulation of ion channels and neuronal signaling. Research into CNIH2 has gained momentum due to its potential implications in neurobiology and neuropharmacology. Primarily expressed in the brain, CNIH2 has been implicated in synaptic plasticity, a fundamental mechanism underlying learning and memory. Studies suggest that CNIH2 may enhance the activity of glutamate receptors, which are vital for excitatory neurotransmission. Furthermore, altered expression of CNIH2 has been associated with various neurological disorders, including epilepsy and schizophrenia, highlighting its potential as a therapeutic target. Understanding the structure and function of CNIH2 through recombinant protein studies can provide insights into its role in cell signaling pathways and its interactions with other proteins. This research may pave the way for new treatments aimed at modulating synaptic function and addressing neurodevelopmental and neurodegenerative diseases.
