Analytical Data
-
Gene name
ATP5MG
- Application
-
Alternative Names
ATP5MG；ATP5L；ATP synthase subunit g. mitochondrial
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q28852
-
Expression Region
2-103aa
-
AA Sequence
AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV
-
Molecular Weight
18.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP5MG, a subunit of ATP synthase, plays a critical role in the ATP generation process within the mitochondria. Given its importance in cellular energy metabolism, research into ATP5MG has garnered attention for its potential implications in various diseases, including metabolic disorders and neurodegenerative conditions. The understanding of ATP5MG’s structure and function is pivotal for elucidating its role in mitochondrial bioenergetics and cellular homeostasis. Furthermore, abnormalities in ATP5MG expression and function have been linked to compromised ATP production, which can lead to cellular dysfunction. The recombinant expression of ATP5MG allows for detailed investigations into its biochemical properties, interaction with other mitochondrial components, and its potential as a therapeutic target. Studies often focus on the characterization of this protein to better understand its contributions to mitochondrial mechanics and its impact on overall cellular health. As research progresses, the insights gained from ATP5MG may pave the way for innovative strategies to mitigate diseases associated with mitochondrial dysfunction, highlighting the importance of effective protein production and purification techniques for advancing this field of study.
