Analytical Data
-
Gene name
SELI
- Application
-
Alternative Names
EPT1; EPT1_HUMAN; Ethanolaminephosphotransferase 1; hEPT1; KIAA1724; Selenoprotein I; SelI
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9C0D9
-
Expression Region
1-599 aa
-
AA Sequence
MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
-
Molecular Weight
93.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SELI (Selenium-containing protein) is a specialized protein that plays a vital role in various biological processes, primarily due to its unique selenium incorporation, which imparts unique structural and functional properties. Research into SELI has gained significant attention, particularly in the context of its potential implications in human health and disease. Selenium is an essential micronutrient known for its antioxidant properties, and its presence in SELI has been associated with improved cellular defense mechanisms against oxidative stress. Furthermore, studies have suggested that SELI may participate in regulating immune responses, enhancing metabolic pathways, and influencing cellular signaling processes. The investigation of SELI's structure-function relationship is crucial, as it may provide insights into its role in various physiological contexts, such as cancer, cardiovascular diseases, and inflammatory conditions. Advanced techniques, including recombinant DNA technology and proteomics, have facilitated the production and characterization of SELI, allowing researchers to explore its interactions with other biomolecules and its functional relevance in cellular systems. Understanding SELI's biological significance could lead to novel therapeutic strategies, utilizing its properties to develop selenium-enriched compounds aimed at promoting health and preventing disease. As the research on SELI evolves, it holds promise for elucidating the intricate mechanisms through which selenium exerts its beneficial effects, ultimately contributing to a greater understanding of the interplay between nutrition and health.
