Analytical Data
-
Gene name
JMJD1C
- Application
-
Alternative Names
JMJD1C；JHDM2C；KIAA1380；TRIP8；Probable JmjC domain-containing histone demethylation Protein 2C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15652
-
Expression Region
2274-2498aa
-
AA Sequence
MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
-
Molecular Weight
45.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JMJD1C (Jumonji domain-containing protein 1C) is a member of the Jumonji C (JmjC) domain-containing family of proteins, which play critical roles in the regulation of gene expression through histone demethylation. Research has identified JMJD1C as a crucial player in various biological processes, including embryonic development, cellular differentiation, and response to environmental stress. It specifically targets methylated histones, particularly trimethylated lysine 9 on histone H3 (H3K9me3), thereby influencing chromatin structure and gene accessibility. Dysregulation of JMJD1C has been linked to several diseases, including cancer and metabolic disorders, making it an important target for therapeutic interventions. Recent studies have focused on the biochemical characterization of JMJD1C to elucidate its enzymatic activity and substrate specificity, as well as its interaction with other regulatory proteins. By understanding the function and regulation of JMJD1C at the molecular level, researchers aim to uncover its potential as a biomarker or therapeutic target in various pathological conditions, further highlighting the necessity for the development of recombinant JMJD1C protein for in vitro and in vivo studies. The production and study of this recombinant protein facilitate the exploration of its demethylase activity and functional roles in epigenetic regulation, providing insights into the broader implications of histone modifications in cellular biology.
