Cat: PAX2000-11189

Recombinant Human SEC22L3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SEC22L3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SEC22C; SEC22L3; UNQ459/PRO784; Vesicle-trafficking protein SEC22c; SEC22 vesicle-trafficking protein homolog C; SEC22 vesicle-trafficking protein-like 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BRL7

  • Expression Region

    1-303 aa

  • AA Sequence

    MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFLVPFVACIFQCYLYLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSDCGV

  • Molecular Weight

    60.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SEC22L3, or Secretory Carrier Membrane Protein 22 Like 3, is a member of the SEC22 family, which plays a crucial role in the intracellular transport of proteins within the secretory pathway. Research into SEC22L3 has gained prominence due to its involvement in various cellular processes, including vesicle transport, membrane fusion, and protein secretion. It is particularly significant in the context of neuronal and immune cell functions, as it facilitates the trafficking of proteins essential for cellular communication and activation. Emerging studies have also suggested a potential link between SEC22L3 and several pathological conditions, including neurodegenerative diseases and immune disorders, highlighting its importance in maintaining cellular homeostasis. Understanding the molecular mechanisms by which SEC22L3 operates could provide insights into these diseases and offer avenues for therapeutic interventions. Given its pivotal role in protein transport, SEC22L3 has become a target of interest in studies aimed at unraveling the complexities of the endoplasmic reticulum's functions and the broader implications of vesicular transport in health and disease. As such, ongoing research is focused on characterizing its structure, regulation, and interaction with other cellular components, promising to enhance our understanding of its functional importance within the cell.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US