Analytical Data
-
Gene name
CKBB
- Application
-
Alternative Names
Creatine kinase B-type. EC:2.7.3.2. Brain creatine kinase. B-CK. Creatine kinase B chain. Creatine phosphokinase B-type. CPK-B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12277
-
Expression Region
1-381aa
-
AA Sequence
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
-
Molecular Weight
67.65 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CKBB (Creatine Kinase B Brain Type) is a critical enzyme involved in energy metabolism, particularly in tissues with high energy demands such as the brain and heart. Its primary function is to catalyze the conversion of creatine and adenosine triphosphate (ATP) into phosphocreatine and adenosine diphosphate (ADP), thus playing a vital role in the maintenance of cellular energy homeostasis. Research on CKBB has gained traction due to its association with various neurological disorders and cardiovascular diseases, where dysregulation of energy metabolism is often observed. The study of recombinant CKBB protein aims to elucidate its structural and functional properties, allowing for a deeper understanding of its role in health and disease. Advances in recombinant DNA technology have facilitated the expression of CKBB in heterologous systems, enabling researchers to produce large quantities of the pure protein for biochemical analysis. This research not only provides insights into the enzyme's kinetics and interaction with other molecules but also offers potential therapeutic avenues, including the development of CKBB-based biomarkers for early disease diagnosis and targeted treatments. By investigating the role of CKBB in pathophysiological conditions, scientists hope to uncover new strategies to mitigate energy deficits in affected tissues, ultimately paving the way for innovative interventions in managing diseases related to energy metabolism.
