Analytical Data
-
Gene name
UNC119
- Application
-
Alternative Names
UNC119;RG4;Protein unc-119 homolog A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13432
-
Expression Region
1-240aa
-
AA Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
-
Molecular Weight
43.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UNC119 is a vital protein originally identified in *Caenorhabditis elegans* that plays a critical role in the regulation of neuronal signaling and cellular transport processes. It is known to interact with lipidated proteins, especially those containing prenyl and fatty acyl modifications, thereby facilitating their trafficking to cellular membranes. The protein's involvement in essential biological pathways has made it a subject of interest in various fields, including neurobiology and cancer research. Research has shown that UNC119 is implicated in the activation of oncogenic signaling pathways and may influence cancer progression and metastasis. Moreover, its function in neurons highlights its importance in maintaining cellular homeostasis and signal transduction. However, a comprehensive understanding of UNC119's structure-function relationship, including its binding mechanisms and the impact of post-translational modifications, remains limited. Therefore, the production of recombinant UNC119 protein provides a valuable tool for structural and functional studies, aiding in the elucidation of its role in cellular processes and potential therapeutic applications. As researchers continue to explore the diverse roles of UNC119, understanding its mechanisms at a molecular level could lead to novel insights in treating neurodegenerative diseases and cancers where UNC119's regulatory functions are disrupted.











