Analytical Data
-
Gene name
CD226
- Application
-
Alternative Names
CD226；DNAM1；CD226 antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15762
-
Expression Region
19-247aa
-
AA Sequence
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHG MVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTW QKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKI QPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSG LYRCYLQASAGENETFVMRLTVAEGKTDN
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD226, also known as DNAM-1 (DNAX accessory molecule-1), is a critical co-stimulatory receptor primarily expressed on the surface of immune cells, including T cells and natural killer (NK) cells. It plays a significant role in mediating immune responses against tumors and viral infections by enhancing the activation and proliferation of these immune cells. The interest in CD226 has amplified due to its potential as a therapeutic target in cancer immunotherapy. Research has shown that the interaction of CD226 with its ligands, such as PVR (Poliovirus receptor) and Nectin-2, can significantly boost the immune response, leading to increased cytotoxicity against cancer cells. Furthermore, CD226's expression and functionality are influenced by various factors, including mRNA isoforms and post-translational modifications. As a result, recombinant CD226 proteins are being developed to better understand its structural and functional properties, assess its role in immune modulation, and explore its potential in enhancing anti-tumor immunity. These studies aim to pave the way for designing novel immunotherapeutic strategies that can improve patient outcomes in cancer treatment.
